PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS69915.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family GATA
Protein Properties Length: 231aa    MW: 25574.2 Da    PI: 9.1645
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS69915.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA47.72.1e-15193222130
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyy 30 
                 C+ Cg+t TplWR+gp g  tLCnaCGl++
  EPS69915.1 193 CRDCGATMTPLWRKGPAGRQTLCNACGLKH 222
                 ****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF134562.4E-6869No hitNo description
SuperFamilySSF577164.75E-12185224No hitNo description
SMARTSM004016.6E-8187230IPR000679Zinc finger, GATA-type
PROSITE profilePS5011413.982187222IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.9E-15191222IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.18E-12192231No hitNo description
PfamPF003208.9E-13193222IPR000679Zinc finger, GATA-type
PROSITE patternPS003440193218IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MAHRSAIRLS KEHGEYMTAR LMMEFAVGMP LQHVILEGDC LALIQTLNHP STMADTRLDT  60
ILQDILHLTS GKMSNKGKGE SQGGDEKEEE KLDLTLSLGH SSKRKETLNK KLWGYNIPTI  120
NPNTITCSSS SFNTHYQATT DYYKYSYDGA MPMAINAAVG NVVVPPSPSN YAYGRSDMAS  180
PNRKRNAHES RVCRDCGATM TPLWRKGPAG RQTLCNACGL KHLRMAKKDG H
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLS8CSV21e-175S8CSV2_9LAMI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1667355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49300.18e-11GATA transcription factor 16
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]